SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925176|ref|YP_003321799.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925176|ref|YP_003321799.1|
Domain Number 1 Region: 12-156
Classification Level Classification E-value
Superfamily CinA-like 2.75e-51
Family CinA-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925176|ref|YP_003321799.1|
Sequence length 163
Comment CinA domain-containing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MANSISLAFQVYRMIGNLTLSVAESCTGGSLASSIVSIPGSSRFFLGGVVAYSNDIKIRI
LGVSERTISIHGAVSSACALEMANNVRKLMGADIALSTTGIAGPEGGTEEKPVGLVYVAI
STPEGSWYIRRIWRGTRAQNIASTNAAALSLLIEYLAQKINPD
Download sequence
Identical sequences D1CDH1
WP_012874012.1.85100 525904.Tter_0054 gi|269925176|ref|YP_003321799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]