SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925395|ref|YP_003322018.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925395|ref|YP_003322018.1|
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.58e-40
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 135-284
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.32e-23
Family Glucose 6-phosphate dehydrogenase-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925395|ref|YP_003322018.1|
Sequence length 345
Comment oxidoreductase domain-containing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSFKIGIIGCGRIVEEGHAPALSNMRHVAEVVALADPSPERRATIENVLNYKVSGQYSSW
KDLLENTPNLDAVLIALPHHLHEPAITDAARFGVNVISEKPLAATLEEVDRIGAVIKEHN
VKLAVIHNYTYSRPMRYALRAIQEGRVGEVFLVRSEGLAGSHYKGKDPSNPDWRTQSTRG
GGGVLLDNGYHNMYVAEAEAQSPVIKVYARVGRYVREQDVDDLAVVMLTHENGATTVVEV
AWAVNGGGAFVHEVHGKLGSIRFKIEAPFVEIYENKIGQWLPLSYADDNFQEGFHGVLQD
IFNAWAQGEDAPTNLAKARHNLAILRAAYLSAQQGTVVDLKDVER
Download sequence
Identical sequences D1CE40
gi|269925395|ref|YP_003322018.1| 525904.Tter_0274 WP_012874231.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]