SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925437|ref|YP_003322060.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925437|ref|YP_003322060.1|
Domain Number 1 Region: 85-274
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.5e-44
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.00000259
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-19
Family Lysine biosynthesis enzyme LysX, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925437|ref|YP_003322060.1|
Sequence length 282
Comment lysine biosynthesis protein LysX [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKVGVLLSRVRAEEKLIFEEFDARGIDVERIYDPELVLDIESPINGYDVILERAINHSRA
VSALRLFNDWGIPTVNTYEVATICGNKLETSAALARCGVPTPRTLIAFTPESALKAIESI
GYPVVLKPLIGSWGRLISLVNDRYAAEALLEHKEILGSYHHSIFYIQEYVEKPGRDIRAF
VVGDKTIAAIYRYSDHWITNTARGGQASNCPVTDEINEISVAAAKAVGGGVVAIDLVESP
EGLKVLEVNYTMEFRNSIQPTGVNIPAYIVDYVIARGEGAPP
Download sequence
Identical sequences D1CE82
gi|269925437|ref|YP_003322060.1| 525904.Tter_0316 WP_012874273.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]