SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925448|ref|YP_003322071.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925448|ref|YP_003322071.1|
Domain Number 1 Region: 183-621
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.72e-121
Family Amylase, catalytic domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 627-730
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.64e-34
Family alpha-Amylases, C-terminal beta-sheet domain 0.00018
Further Details:      
 
Domain Number 3 Region: 17-116
Classification Level Classification E-value
Superfamily E set domains 6.53e-18
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily E set domains 0.0000000000084
Family E-set domains of sugar-utilizing enzymes 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925448|ref|YP_003322071.1|
Sequence length 731
Comment 1,4-alpha-glucan-branching protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MQIEGACRIEDLINGTCYDPHSILGMHPVERNGRRCIELRVWVPGAIKVSALDYKTNEEI
LPLERVHEAGFFIGTFPTRTEVFPYRLRISTAHHTWVQEDPYRFLPTIGELDLYYIGEGT
HRKLYEVLGAHLREIDGVKGVSFAVWAPNARGVSVIGDFNGWDKRRYPMRVLGSSGVWEI
FLPGVQVGEKYKYAINGADGIEREKADPLAFYSELRPRTASIIYDLSGYKWKDREWMLRR
LENNPYKKPMNIYEVHLGSWKRHPDGSWLSYRELADELVPYVKRMGFNYVEFMPLLEHPY
DGSWGYQVTGFYSATSRFGTPDDLRYLIDRCHQAGIGVIIDWVPAHFAVDEHGLCRFDGT
YLYEHEDIRRRFQPDWGTFSFNYGRNEVRNFLTASALFWVKEFHVDGLRVDGVSSMLYLD
YSRGPGEWTPNKYGGRENLEAIDFLREMNSLVYAEGEGAITIAEESTAWPGVSRPVYLGG
LGFGFKWNMGWMHDTLEYFRKDPIYRKYHHNDLTFSMVYAYNENFILSLSHDEVVHGKGS
LVNKMPGDEWQQFANLRLLFAYQWAHPGKKLIFMGDEFGQRSEWNHDWQLDWWVLQFGYH
QGVQRLLQDLNRLYLHEPALYRLDHDPKGFTWLDYSDWENSVISFARWSGDGNNHIVCAF
NFTPVPRYNYRIPAPHLGKYREVLNTDAQIYGGSGIGNMGEVSSEVVMHNGHPYSVAITL
PPLGAVFFKPM
Download sequence
Identical sequences D1CE93
gi|269925448|ref|YP_003322071.1| 525904.Tter_0327 WP_012874284.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]