SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925449|ref|YP_003322072.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925449|ref|YP_003322072.1|
Domain Number 1 Region: 142-480,509-586
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.32e-138
Family Amylase, catalytic domain 0.000000168
Further Details:      
 
Domain Number 2 Region: 7-156
Classification Level Classification E-value
Superfamily E set domains 1.18e-49
Family E-set domains of sugar-utilizing enzymes 0.002
Further Details:      
 
Domain Number 3 Region: 598-699
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.72e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925449|ref|YP_003322072.1|
Sequence length 710
Comment glycogen debranching protein GlgX [Thermobaculum terrenum ATCC BAA-798]
Sequence
MNFTFCPGKPYPLGATWDGSGVNFALFSPGAEKVELCIFNNPFEEKESVRIPVTNKTNYI
WHVYLPEARPGLLYGYRVYGPYDPARGLRFNHNKLLIDPYAKAIAGDIKWSDDVFGYRIT
GHDDQDLIASETDSSPYVPKSVVVDTSFTWGDDKRPNIPWKDTIIYELHVKGFTQLHPGL
PENLRGTYAGLAHHEIIKYLKDLGVTAVELLPVHHFVRDRYLVEKGLTNYWGYNTIGFFA
PDSAYSSSGFMGQQVHEFKTMVRKLHKAGIEVILDVVYNHTGEGNHFGPTLSFKGMANDR
YYRLSPDSPRFYIDYTGTGNTLDTTEPYSLRLIMDSLRYWIQEMHVDGFRFDLAATLGRE
AHHFDKFGSFLDIISQDPVISQVKLIAEPWDLGEGGYQLGNFPEGWAEWNDRYRDNIRRF
WRGDPGQVRELGWRLSGSSDIFASGGRGPNASINYVTSHDGFTMRDLVSYNSKHNEANGE
GNKDGTDNNLSWNCGFEGETDNQAVLSLRRRQIRNFLTTLLVSQGTPMILHGDEVGRTQR
GNNNAYCQDNETTWQPWDLEEWQRELLEWTKQVIAFRKAHPVLRRGEYYKGQIIEGYGTK
DLTWLRPDGREMTEEDWLNQEIRAFGMLLSGASALECVDDNILVIFNASKRNITFYLPQP
PSGLRWQLVLDTSNPRYQETLNRRVAKNYRLAPTSMAIFKYPIQSPRTES
Download sequence
Identical sequences D1CE94
WP_012874285.1.85100 525904.Tter_0328 gi|269925449|ref|YP_003322072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]