SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925506|ref|YP_003322129.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925506|ref|YP_003322129.1|
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000103
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925506|ref|YP_003322129.1|
Sequence length 269
Comment serine/threonine phosphoprotein phosphatase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVVSDGAGSAARGDEGSE
FACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERANSCEAQISDYASTLLAA
VVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTTFFLTDNNSHENLLILSL
DDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQFDGYLQELSEQLKNFLGS
PRVNEYTEDDKTLLLASRVIGQQLSEVPD
Download sequence
Identical sequences D1CEF1
525904.Tter_0385 gi|269925506|ref|YP_003322129.1| WP_012874342.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]