SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925558|ref|YP_003322181.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925558|ref|YP_003322181.1|
Domain Number 1 Region: 135-479
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.82e-70
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 484-601
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.81e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00028
Further Details:      
 
Domain Number 3 Region: 78-131
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.000000628
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925558|ref|YP_003322181.1|
Sequence length 601
Comment arginyl-tRNA synthetase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLQQEISQAKEAIREAIAQLGLPQPENIDLRQIPFSGQWGLATSVCHQLARNEVQVDIPE
GLSKKEARKLLEAASRERAQSLAESIANYLSRKGIFADVQAQNGYVNMFFEPSDVALRLL
ATVHEQGDSYGRGNPKSETVMVEYGQPNTHKQFHIGHLRNTALGDSIARILDFAGYRKVL
KASYIGDIGAHVIKWLWGYNKWHSGEQPPADPYKIGPWLESIYVEANSAIESNPDYQREY
RDLFARWDRRDPEVVELWRRTREWSLNYFRRIFKELDVNFDVWFYESDFEEPGKKIVQDL
LNKGVAEIDEGAPIVRIDQKLGLEKETYRTIVLQRSDGTSLYQTKELALTRTKFDEYKVD
RILNVVDVRQTLYFQQVFKVLELLGYEQARNSQHIPYELVSLPTGPMSSREGTTVGYDEF
ATEMYERALEVVREKNPEMPQEQQERIARIVSMGSMKFGMLNRDNTRVLVFDKEEALDFD
GFSAPYVQYAHARACRILEKAPDIDWENLRIGELSTVETNLLEMISRLNESVERAAREYK
PLHVVNYVYELAKTFNEFYRVSPVLRAEEEVRNFRLAVVYATKVCLANSLYLLGIEAPEV
M
Download sequence
Identical sequences D1CEK3
gi|269925558|ref|YP_003322181.1| WP_012874394.1.85100 525904.Tter_0438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]