SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925621|ref|YP_003322244.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925621|ref|YP_003322244.1|
Domain Number 1 Region: 107-217
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 1.44e-36
Family KorB DNA-binding domain-like 0.000093
Further Details:      
 
Domain Number 2 Region: 27-117
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 3.92e-25
Family ParB-like nuclease domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925621|ref|YP_003322244.1|
Sequence length 282
Comment parB-like partition protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSRPKGGLGRGLDALIPQTSSTFDNLVHIDQIIANPYQPRGSMDEGRLQSLVESIKQNGI
LQPLLVQRQGDHYQLIAGHRRLHAAKMAGVQQVPVVIREARASDNMLLLALIENLQREDL
NPIDEAKAYRELQRKFGFSTDEIAERVGKSRPAVANALRLLELAPEVKEMLIQGQISEGH
ARALLGLRDPQSQINTARLVVERGLSVRQTEQLVKRLRDNSGQRSSQAIDPEVTYLEERF
RQALGTKVSLSRSRRGGKLVIHFYSEEELQSIYEVIVGDRSR
Download sequence
Identical sequences D1CER6
WP_012874457.1.85100 525904.Tter_0501 gi|269925621|ref|YP_003322244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]