SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925701|ref|YP_003322324.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925701|ref|YP_003322324.1|
Domain Number 1 Region: 207-384
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 2.62e-59
Family Oxidoreductase molybdopterin-binding domain 0.0000511
Further Details:      
 
Domain Number 2 Region: 385-496
Classification Level Classification E-value
Superfamily E set domains 1.96e-26
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|269925701|ref|YP_003322324.1|
Domain Number - Region: 17-185
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0523
Family Glycerol-3-phosphate transporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925701|ref|YP_003322324.1|
Sequence length 501
Comment oxidoreductase molybdopterin binding protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEAHKETGQEYKLGYGLLAAVFAILLIAFFRILFQVRSPIEVLLDRLLTLIPMRWFESLL
GFFGGYAKPFAYLVAVLVAIVGGGLFLLIARFLSSTFGTTLRKTFSILCLALAILLAILV
LSLGSSPSTLALTLGAVFVYYAGVQYFVSSSQAPKKDVADSSRRRFLRQLGATVIGVAAA
GIVVSIIQRLLSQATITSTGKASGNMPEPFTPNDEFYVVSKNILDPNVDSTSWKLRIGGL
VQKPFELTLDEIKQLPPVEQDQTLECISNPVGGDLISNAKWKGIRLRDLLEQVQVREGVI
DIKFTCADGYTESIPLEKAMEPTVLLAYEMNGEQLPSKHGSPLRLLVPNIFGMKNVKWVE
RIEAVNEDYKGYWQQQGWSDIATIQTMSQIRVPASNSEIQIGEETEIAGIAFAGSRGINK
VEVSTDAGKTWQTAQLDPEIGPLCWRFWRYRWTPESEGYYTLVVRAQDGEGNWQTEERQP
TLPSGATGYHSIQVRVTGSSQ
Download sequence
Identical sequences D1CEZ6
WP_012874537.1.85100 gi|269925701|ref|YP_003322324.1| 525904.Tter_0584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]