SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925770|ref|YP_003322393.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925770|ref|YP_003322393.1|
Domain Number 1 Region: 202-321
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.02e-42
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.0000739
Further Details:      
 
Domain Number 2 Region: 4-161
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.77e-23
Family ETFP subunits 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925770|ref|YP_003322393.1|
Sequence length 327
Comment electron transfer flavoprotein subunit alpha [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSNDIWIYGEHSNGRLAENTRDILSKASSMGRTSLILLGREADRVVDEACEAGASEIIVD
ADPRYDEYLAEPHARTLYRLIDQGTPPRILLFTFDPPSRDIASRLASKLGTGALSNVLDV
SEEDGLTVAAVQWGWSYTAKCRLKGKNPHILLIRQGAFSDHSLKMANANNVGGITRYISM
FEPDETFPRVIRSTVERKPGPTLTNARLVIAGGRGMGSADNFRLIEELVAMLDGAIGTTR
AAVDAGWRPYTEQIGQTGASIRPDVYIACGISGAVHHMKGVRGSKSIIAINKDPDAPIMR
MADVGIVGDAVELLRLLREKLQERLGR
Download sequence
Identical sequences D1CF65
525904.Tter_0654 gi|269925770|ref|YP_003322393.1| WP_012874606.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]