SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925809|ref|YP_003322432.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925809|ref|YP_003322432.1|
Domain Number 1 Region: 3-187
Classification Level Classification E-value
Superfamily ITPase-like 8.5e-59
Family Maf-like 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925809|ref|YP_003322432.1|
Sequence length 200
Comment maf protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLHRKIVLASSSPRRKELLSGLGIQFEIFSPDIPEDVAPGESPWNLARRLAYEKWGNVVS
KSGFEDYLVITADTVVDLDGRSLGKPNSREEAFEMLKSLRAREHLVHTAVCVGDGTLLLC
SVVTTRVKMRNYSDGEIASYVETGSPMDKAGGYAVQDEFFSPVERMEGSYTNVVGLPLEA
VVRMLERFDIKMLGGAAVVR
Download sequence
Identical sequences D1CFA4
gi|269925809|ref|YP_003322432.1| WP_012874645.1.85100 525904.Tter_0693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]