SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925829|ref|YP_003322452.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925829|ref|YP_003322452.1|
Domain Number 1 Region: 9-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-63
Family G proteins 0.000000127
Further Details:      
 
Domain Number 2 Region: 308-400
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.91e-36
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000691
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Translation proteins 7.66e-30
Family Elongation factors 0.00000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925829|ref|YP_003322452.1|
Sequence length 400
Comment translation elongation factor Tu [Thermobaculum terrenum ATCC BAA-798]
Sequence
MAKQRFERTKPHVNVGTIGHVDHGKTTLTAAITKVLALKGEAQYRPFETIDKAPEERARG
ITISIAHVEYETDKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAPDGPMPQTREHI
LLARQVEVPAIVVFLNKVDMMDDPELLELVEMEVRELLTRYGFPGDEVPIIRGSALRALE
SSSTDINAPEYQPILELMDAVDEYIPTPQRAVDKPFLMPIEDVFAIKGRGTVVTGRVERG
RIKVGDTVEIVGLRAERRSTVVTGVEMFQKTLDEGVAGDNIGCLLRGIERTEVERGMVLA
APGSINPHTRFRAEVYVLSKEEGGRHTPFFSGYRPQFYIRTTDVTGEVKLPEGVEMVVPG
DNVNLEVELIAPVAIEEGLRFAIREGGRTVGAGVVTQILE
Download sequence
Identical sequences D1CD68
gi|269925829|ref|YP_003322452.1| gi|269926932|ref|YP_003323555.1| WP_012874665.1.85100 525904.Tter_0713 525904.Tter_1827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]