SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925846|ref|YP_003322469.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925846|ref|YP_003322469.1|
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.37e-34
Family Ribosomal protein L6 0.000052
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.58e-26
Family Ribosomal protein L6 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925846|ref|YP_003322469.1|
Sequence length 184
Comment 50S ribosomal protein L6 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSRIGNAPIQIPSGVDVTVQDGEVIVKGPKGELRQKIVGEIEVIREDSTLRVVRKSDEKY
HRSLHGLTRTLINNMIIGVTQGFRKDLEISGVGYRATKEGDSLVLSVGYSHPVRLQPPQG
ITYVVESPTRISVQGIDKQLVGAEAARIRSVREPEPYKGKGIKYVDEVIRRKAGKAGKAG
GGRR
Download sequence
Identical sequences D1CFE1
525904.Tter_0730 WP_012874682.1.85100 gi|269925846|ref|YP_003322469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]