SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925885|ref|YP_003322508.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925885|ref|YP_003322508.1|
Domain Number 1 Region: 93-264
Classification Level Classification E-value
Superfamily alpha/beta knot 2.94e-37
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00054
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily L30e-like 1.04e-18
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925885|ref|YP_003322508.1|
Sequence length 267
Comment tRNA/rRNA methyltransferase SpoU [Thermobaculum terrenum ATCC BAA-798]
Sequence
MITSRSNQQVKWFRLLRERRGRKASGAFLVEGPRAIQQAMVAGHKPLKVLYSPEVVVRRD
VVNKVLGQIGSETPLLEVSEDVLSSVSDTVTSQGIIAAFELLSWHPREGVNANAGPVLVL
DRVSDPGNVGTLLRSAAAAGSAAVLLSEGSADPYNPKAVRASAGALFAVSFAVLPWEEIH
EVLHTVPKRFAAYYSDSSQAYYLADLCPPCAILVGSEASGLSHQALSLSTHNLWIPMQNN
IESLNAAVAGSILLFESRRQMLIREGR
Download sequence
Identical sequences D1CFI0
gi|269925885|ref|YP_003322508.1| 525904.Tter_0769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]