SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925887|ref|YP_003322510.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925887|ref|YP_003322510.1|
Domain Number 1 Region: 206-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-61
Family B3/B4 domain of PheRS, PheT 0.0000142
Further Details:      
 
Domain Number 2 Region: 35-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.93e-36
Family Myf domain 0.0043
Further Details:      
 
Domain Number 3 Region: 468-697
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0017
Further Details:      
 
Domain Number 4 Region: 707-804
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.97e-24
Family Anticodon-binding domain of PheRS 0.0005
Further Details:      
 
Domain Number 5 Region: 405-476
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.46e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925887|ref|YP_003322510.1|
Sequence length 809
Comment phenylalanyl-tRNA synthetase subunit beta [Thermobaculum terrenum ATCC BAA-798]
Sequence
MRVPVSWLREYVEFSCSIEELAHTLTIAGLEVENIERIGQEWENIYVGLVLQVEKHPNAD
RLQVAHIDYGHGQVSIVTGAPNIAPGQKVALALAGATLVDPYSDQHKTFKLKPSKIRGIL
SEAMACSEKELGLGEDHTGILVLDPEAPVGAKLQDVLGDHILDIALTPNFSYANSIVGIA
REVAALTGTKAKVPVPNVELSGDVGVDAWVESEDLAARYMLQRLDNIRIGPSSAKIRRRL
LLCGMRPVNNVVDITNYVMLELGQPLHPFDADKVRGKVAVRSSYPEEQLETIDHQLRTAP
PDTIMIADDEKPIAFAGIMGGLNTEVTDDTRNILLESATFNAPRIRRAARLLGLRSEASS
RFEKGMDPELAGLALARAVELLQQECGAQPKGAPFDWYPNPKKRAYIDFPVYEVKRLLGI
DIPKDQVERILTSLEFEVQEEGDLLKVLPPSYRSDVSIPADIVEEVGRIWGYEELPSQLP
GGTIPFNLTDRFFWIEKKAREWLAAAGLQEVINYDLISARLISKMASLYHEGMHPPVWRP
LDEVIKVINPTSPEREYLRPSLIPGLLQNVSDNLRFVDKVWIYELDRVFIKANGERPQEP
KRLAIAMAGTRWPISPHLPQAKTTIFDLKGTIQAFLHYLGIEVEMLPSQLGPDAVNVLQV
SVGGNVLGNIFQVDPTLLRDLDIDEDVFVAELDWEQIKQHARLDRNYVHVSRYPIVRQDL
AVLVSASIPAGNVTRVIWEQGRPLLVQCELAEVYQGDQIPEGTKSLLYKLAFQAEDRTLT
EEEATKVRQKIENALRSEVDAKIRGVDIE
Download sequence
Identical sequences D1CFI2
WP_012874723.1.85100 525904.Tter_0771 gi|269925887|ref|YP_003322510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]