SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925917|ref|YP_003322540.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925917|ref|YP_003322540.1|
Domain Number 1 Region: 84-236
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-32
Family RecO C-terminal domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.74e-16
Family RecO N-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925917|ref|YP_003322540.1|
Sequence length 254
Comment DNA repair protein RecO [Thermobaculum terrenum ATCC BAA-798]
Sequence
MQERVYKTQAIVLRRFDFGETGRQLIAFTPDFGKISLIAKGTKKPTSKLAGHLEPLTLTQ
LVVASGRNIDTVTQAQTIKSFANVRSDSRVIPFGLIVAELLDRMIAEGEPNREIWALAVD
TLERLNNTNDPWKPVTYFQVRLLILAGYQPELKVCSRCGQDVAPESVYFSLSAGGMVCRE
CSKGDPTAVVVSPNVIKALRLASLPSYEVFEKVRIPQDLRLDVEAIIRRIYAHILESDIR
SIAMLRTFYGTDEI
Download sequence
Identical sequences D1CFL2
525904.Tter_0801 gi|269925917|ref|YP_003322540.1| WP_012874753.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]