SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925950|ref|YP_003322573.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925950|ref|YP_003322573.1|
Domain Number 1 Region: 28-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.22e-77
Family Alanine racemase-like, N-terminal domain 0.00000518
Further Details:      
 
Domain Number 2 Region: 257-413
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.91e-56
Family Eukaryotic ODC-like 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925950|ref|YP_003322573.1|
Sequence length 418
Comment diaminopimelate decarboxylase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLDTAFHYRGDTLYCEDVPLVDLVKEYQTPLYVYSANYIRNAYQKLKESFGGFPTKICYS
LKSNPNIWIGKLLADLGAGADVTSGGELFRALKAGFNPEDIVFAGVGKSSREIVEALRSG
VGLFSIESEQELRKISELAQSLNRVANISIRVNPNIDPHTHEKITTGLRSNKFGVPIEEA
LRVYQLACTLPAIRIVGIGMHIGSQLVNLDPVIQAANTILDMAEELINTGIRLEYIDIGG
GFGIKYKDESPEDPEIVAKALERRLRDLKLKLIIEPGRFISGPSGALLTSVLYTKTSGGK
KFVIVDAGMNALIRPALYDAYHHIQPLVRRDKTEIVDVVGPICESSDYLAKDRLLPQVFP
TETIAILQAGAYGFAMASEYNSHPRPAEILVDGNKVRLIRKRQTYEDLIRLELEAEDL
Download sequence
Identical sequences D1CFP5
525904.Tter_0834 gi|269925950|ref|YP_003322573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]