SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925973|ref|YP_003322596.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925973|ref|YP_003322596.1|
Domain Number 1 Region: 52-205
Classification Level Classification E-value
Superfamily PEBP-like 6.67e-46
Family Prokaryotic PEBP-like proteins 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925973|ref|YP_003322596.1|
Sequence length 206
Comment PEBP family protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MYDFTIIKSTKLSVYIRRIADILVILGVLLVLSCMPGAAREDTFPQSNLEKIEITSPDFI
QENSKLVIPTKFTCDGEDISPTLKWKGVPPKAQSLVLIMDDPDAPGHISPWSHWVMFNIP
ATQIGLPQALPRTIRLPNGAVQGVNDFKEHGYRGPCPPNGTHRYYFHLYALDIRLNLTPN
ATRDAVLKAMKGHVIAYGELVANYSR
Download sequence
Identical sequences D1CFR8
gi|269925973|ref|YP_003322596.1| 525904.Tter_0857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]