SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926050|ref|YP_003322673.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926050|ref|YP_003322673.1|
Domain Number 1 Region: 17-248
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.26e-66
Family Alanine racemase-like, N-terminal domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 241-376
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.49e-46
Family Alanine racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926050|ref|YP_003322673.1|
Sequence length 376
Comment alanine racemase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLAERVKVATGPTWVEVDLNAIRHNLRLYLDKCPGSKVIAVVKGDAYGHGIIEISKTVLD
AGAWGLGVARVSEGLLLRSSGIDAPIIVLGYSSEQEIKQAVASDLAISVSTEKMLDWILA
TAREVGRIPRIHLEVDTGMRRLGVKFEDAAQIVHYIHGTNSVYLEGIFTHFASADDPEGF
LFKRQLSMFQDLIHLIRERGEVPPIVHAANSAAALYAPESHFDAVRIGIGLYGVQPLQFK
TYPLRPAMALRSVVARVLDVHAGEGVSYGHTYVAKESHRAAVIPCGYADGYPRILSNKGE
VIVSGIRCPVIGRVCMDNLIVKLPEGVDARVGDAVTLIGSQGSEAVDAGYLARLAGTIPY
EILCGIGRRPEKIYIN
Download sequence
Identical sequences D1CFZ5
gi|269926050|ref|YP_003322673.1| 525904.Tter_0934 WP_012874886.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]