SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926066|ref|YP_003322689.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926066|ref|YP_003322689.1|
Domain Number 1 Region: 114-296,429-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.72e-102
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000735
Further Details:      
 
Domain Number 2 Region: 293-424
Classification Level Classification E-value
Superfamily GAD domain-like 3.27e-37
Family GAD domain 0.00022
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.75e-34
Family Anticodon-binding domain 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926066|ref|YP_003322689.1|
Sequence length 603
Comment aspartyl-tRNA synthetase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSKTWTCGELNTKHIGQEVTLYGWVNSRRDHGGVIFIDIRDRWGITQVVFSPDNQDAFRL
AETVRSEWVISVTGTVRRRPPGTENPRMSTGEIELAASRLEVLNKSAPLPFDLDDDNLPD
ETVRLQYRYLDLRRPKMLRNLQLRHKVTKFIRDYLTARDFIEIETPILIKSTPEGARDYL
VPSRLYPGHFYALPQSPQQLKQLLMVAGVERYFQIARCFRDEDLRADRQPEFTQLDLEMS
FVTQEDILQLTEDLFTSLTEELTDKKILYKPFKRISYEESWNKYGTDKPDIRYGMEISDI
SDIVANTDFRVFKDTLAAGGTVRGFAVPEAASFTRRQLDDLTNLARSFGAKGLVWFAIDD
LARGVEGVRSPVTKFFSDDQVVAIAHKLGANNGDLMLIVADKTLQALDVLGRLRSHMAHE
LGLVDQDVIAYAFIVDPPLFEWNEDEGRWDPTHHPFTAPYPEDEPLLDSDPGKVRAMAYD
IVCNGYELGSGSIRIHKRDLQAKIFEILNYTPEDIEQRFGPLLKAFEYGAPPHGGIAPGI
DRLVMVLADEPNIREVIAFPKNQAGVDLMLNAPSPVDEEQLRELHIEVRLPEPESSTADS
KVQ
Download sequence
Identical sequences D1CG11
525904.Tter_0950 gi|269926066|ref|YP_003322689.1| WP_012874902.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]