SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926075|ref|YP_003322698.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926075|ref|YP_003322698.1|
Domain Number 1 Region: 199-452
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.14e-58
Family N-type ATP pyrophosphatases 0.000000954
Further Details:      
 
Domain Number 2 Region: 411-531
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 3.66e-52
Family GMP synthetase C-terminal dimerisation domain 0.0000113
Further Details:      
 
Domain Number 3 Region: 22-243
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.72e-49
Family Class I glutamine amidotransferases (GAT) 0.00000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926075|ref|YP_003322698.1|
Sequence length 531
Comment GMP synthase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSAHISEERQHSVETMLSQDVGKTVVVVDFGSQYSQLIARRVRELRVYSHLVPYDATWET
VSSLNPGAVILSGGPSSVYEPNAPRLPKWVLDSGLPVLAICYGLQLIAHEMGGQVAPANV
KEYGPAELQVEDESSPLFDGLPKSQRVWMSHGDSVISLPEGFWCIGSTVASPYSVVTNGK
IYGLQFHPEVVHTHYGREIISNFLFKIAGLEPVWTPSHFIEESIQRIKDEVGQAKVICAL
SGGVDSSVAATLIHKAIGDRLVCIFVNNGLLRLNEAEEVLGVLRDQQHLNIRYVDATDRF
LSALHGVMDPEEKRKRIGECFIRVFEEEASKLGEIEFLAQGTLYPDVIESATADTKAAAK
IKTHHNVGGLPPDLKFKLLEPLKYLFKDEVREVGKNLGLPDHIVYRHPFPGPGLAVRIIG
EVTPERLDIVRRCDAIVRQEIEKAGMYREIWQAFAVLTPIRTVGVMGDARTYGYLVAVRA
VTSEDAMTAHWARIPHEVLDSIGSRIVNEVHEVTRVVYDITNKPPGTIEWE
Download sequence
Identical sequences D1CG20
525904.Tter_0959 gi|269926075|ref|YP_003322698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]