SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926076|ref|YP_003322699.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926076|ref|YP_003322699.1|
Domain Number 1 Region: 107-317
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.86e-50
Family BC ATP-binding domain-like 0.0000337
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.31e-28
Family BC N-terminal domain-like 0.00033
Further Details:      
 
Domain Number 3 Region: 326-418
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.51e-24
Family BC C-terminal domain-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926076|ref|YP_003322699.1|
Sequence length 430
Comment phosphoribosylamine/glycine ligase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSSSTERVLVVGSGGREHAIVDGLIRTHPTLEVFVYPGNPGMWQLAQRIRPEDNSIGALV
RASVEKGIGLVVVGPEAYLDQGIVDAFTAAGIPCFGPTKAAARLETSKSWAKQVMRLAGV
PTAEYREFSDPWEIRSYISSLGRRVAVKADGLAAGKGVLVTDNPVEAAEFAELYLSSPGS
KVIVEEALSGKELSLFALVNGDMVVPFSHAQDYKPAYDGDKGPNTGGMGAICPADSPSAL
TEELTEEIITPVARQMKTMGVPFCGVIFAGLMLTEDGPYVLEFNARFGDPEAQVMIPRLD
ADLYELIQCIVSGQELSTPLAFKRLFACGVTIASEGYPVSRAEPEPITIGNLPEGTYLYH
AGTSIDNNGKLIAIGGRVFTAVGLGNDLDDARDKAYSLASRVSFKGAWYRRDIGSNWIDL
AWRRRAESNR
Download sequence
Identical sequences D1CG21
525904.Tter_0960 WP_012874912.1.85100 gi|269926076|ref|YP_003322699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]