SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926085|ref|YP_003322708.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926085|ref|YP_003322708.1|
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-33
Family Myf domain 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926085|ref|YP_003322708.1|
Sequence length 112
Comment export-related chaperone CsaA [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSYIDFEQFSEVDIRVGRIISVEAFPEARKPAYKLTIDFGSSIGTKRSSAQITDNYSPDD
LVGKLVLAVCNLRPKRIAGFVSEVLVLGVPDENNNVVLVSPDKEVPIGGKLY
Download sequence
Identical sequences D1CG30
525904.Tter_0969 gi|269926085|ref|YP_003322708.1| WP_012874921.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]