SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926106|ref|YP_003322729.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926106|ref|YP_003322729.1|
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-78
Family Protein kinases, catalytic subunit 0.00000518
Further Details:      
 
Domain Number 2 Region: 331-391
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000107
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926106|ref|YP_003322729.1|
Sequence length 551
Comment serine/threonine protein kinase with PASTA sensor(s) [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSTRYGRYEVKRKIGTGGVATVYLATDTLLGRSVAIKVLNPDVDPGLKRRFLSEARAVAV
LNHPNIVDVYDVGEEDGTPFIVMEYVDGQSLKEFIKNQGRLPLERAKAIVSQVADALSYA
HKNKIIHCDVKPQNILISKDGRAKLVDFGIAQAQIDSTQTSSGRAYGTPLYMAPEQLLGD
KVDERTDIYSLGLVLWECITGTPPQRSQVWEPVRLDQGKVRLPPEVLRIIKKATSQLPED
RYQSVDAFLRDLQNLSPRSAAAFSQESTVTIPTGFVPKNGITNRRRRRIRALPIALLLVM
LIIAVTLWRWPDVYSLGRGLSSGALTSSDVKVTVPSFVGMSLRSARQLAQRSDIQLRVRY
EDGRAGSVVVSQSPPPGEKVDKGSYVTVVLSSQKGTSENAPSGSPTPNIEPVPGKIFGQL
LATNNVHVKTTVDGDTNEFDLLPGEYRQLEANTYLRIEANPARDLMVTITTASGKRSGNL
LDLASQLSGESIAGPSAWISFGSENDTNNEQSISPSKQSPIVQVEQKGSKNSKDLPKPPK
PPKPEKEGPKR
Download sequence
Identical sequences D1CG51
gi|269926106|ref|YP_003322729.1| 525904.Tter_0991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]