SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926166|ref|YP_003322789.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926166|ref|YP_003322789.1|
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.97e-49
Family PP-loop ATPase 0.00022
Further Details:      
 
Domain Number 2 Region: 338-425
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000115
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 198-299
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000123
Family MesJ substrate recognition domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926166|ref|YP_003322789.1|
Sequence length 442
Comment tRNA(Ile)-lysidine synthetase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MILGLSGGADSIALFHVLYELRSILGINISVAHFDHRLRPESSDQASQLAKYIEQFDVNF
YLGSADVAGAALQAKASIEDTARKYRYDFLAACARKENALVCVAHNQQDQAETFLLNLAR
GTGLDGLCGMLPIDRVPGNPDVELVRPFLGIAHEDIRNYCRLNSLPVIEDPSNLSLDFTR
NKIRHLVLPALKQANQEVVKHIALTTSILQQEKRLLDSRALDFLAQHSIIRHNFISVELV
AVMNSPRSLIIRALKMALSQAFGSDEGFGARHLEALYLLARSKSGNSIDLPGGIRAIKAP
QALIVWAGILPMDAIYSLPLMEDDGTLSPNWDWEVTPSAALVQPHALPGNNLHEHVVCDI
NKIRLRPARRSDKFIPLGMKFEKTVDEFLLDRKVPYFIREHVPVIEQDGEIIWLVGWRID
DRHKILYNYEPYVCIRFYRKGN
Download sequence
Identical sequences D1CGB1
gi|269926166|ref|YP_003322789.1| 525904.Tter_1051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]