SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926178|ref|YP_003322801.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926178|ref|YP_003322801.1|
Domain Number 1 Region: 164-452
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 4e-31
Family NadC C-terminal domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 14-166
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1e-20
Family NadC N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926178|ref|YP_003322801.1|
Sequence length 454
Comment nicotinate phosphoribosyltransferase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSVFDRKRLPVSTFKLDVERMRQGWYSDKYFLNIVGLLTALAEDGYPVEWSSPTSIGATK
GLGANEIGNIEVEMQIFHRRKPYAVVVGVDKALAILRECTGYYDKNGCFVNTFDKLEVEA
VHDGEMVPYDGDPSNVVPVMRIRGRYRDFALLETPIVGVLTRGSRVATNVYETLKAANGK
TVLFFPARFDAHEVQAADGYAYSIAVQLFNHKYAKDAGISVSTDEQGSWWGGLGGGTIAH
AAIASFLGDTAAAMMAFARTRPVDIPRVALVDFHNDCVSDTLQVMRAMFMEFKRCVDEGN
YEEAEKFRLYGVRPDTSGSLRDKSVEPLGDPELDLGVVPRLIFNMRNAMDNAWKDWDLPP
EWEERAKEWCRQVKIVASGGFTPERIKKFEQLGVPVDIYAVGSWLFNNSKDDGTNTDFTA
DVVRVRVNGEWIEMAKAGRRPGSNPALERVRPDY
Download sequence
Identical sequences D1CB14
525904.Tter_1063 WP_012875014.1.85100 gi|269926178|ref|YP_003322801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]