SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926190|ref|YP_003322813.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926190|ref|YP_003322813.1|
Domain Number 1 Region: 347-579
Classification Level Classification E-value
Superfamily PHP domain-like 2.09e-51
Family PHP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 166-325
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.03e-38
Family DNA polymerase beta-like 0.0033
Further Details:      
 
Domain Number 3 Region: 12-92
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 6.54e-19
Family DNA polymerase beta, N-terminal domain-like 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|269926190|ref|YP_003322813.1|
Domain Number - Region: 101-159
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000102
Family DNA helicase RuvA subunit, middle domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926190|ref|YP_003322813.1|
Sequence length 584
Comment PHP domain-containing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEAKKAVRDQIISNHDIAEKFRLLADLLEIKGEASYKIAAYRKAADSIDHTPEPLSTLRQ
QGKLETIPGVGKAIAQKIEDLLDTGTFELLEEVTSEYPPTLRELLQVPDLGPKRVKLLWG
ELKVGSLDALELAIEDGRIYKVKGLGPKAIERIIEGLKSLKGRDIRIPIGKARELGKRIV
QQLLEKTDKVEKIELAGSIRRFRETAGDIDIVAASEHPEDIIDTFCSLPMVQDVNMKGEN
RCRVMIEGGIQVDLICLPAQHWGTLLLHFTGSRDHNLHLRDLALERGAHMSEYGFKKNEQ
LITFSTEEEVYKFLGIQYVPPEMREDRGEIELSLIHQLPKVIRQKDIRGDLHMHSTWSDG
KCSIRDMALAARSLGYEYICITDHSQSLGIARGLTPERIVEQRKEIESLNKELAPFKILQ
GIEMEVLSDGSMDLPEEVLRDLDLVIASVHSGLRQGREKVTSRALAAIRHPLVDILAHPT
GRIIGSREGGDFDLETIFREAARTGTILEVDGDPNRLDLRDVNAQEAVDSGCLISISSDA
HSIEGLYNMEYGVGTAARGWIRPQDVINTRPLDEMLKLLKRNRS
Download sequence
Identical sequences D1CB26
WP_012875026.1.85100 gi|269926190|ref|YP_003322813.1| 525904.Tter_1075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]