SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926256|ref|YP_003322879.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926256|ref|YP_003322879.1|
Domain Number 1 Region: 52-300
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.76e-18
Family Galacturonase 0.069
Further Details:      
 
Domain Number 2 Region: 437-521
Classification Level Classification E-value
Superfamily PKD domain 8.11e-17
Family PKD domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1165-1296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000479
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.033
Further Details:      
 
Domain Number 4 Region: 238-417
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000044
Family Pectate transeliminase 0.052
Further Details:      
 
Domain Number 5 Region: 1059-1163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000851
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.051
Further Details:      
 
Weak hits

Sequence:  gi|269926256|ref|YP_003322879.1|
Domain Number - Region: 912-1025
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000111
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 
Domain Number - Region: 743-857
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0109
Family beta-mannanase CBM 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926256|ref|YP_003322879.1|
Sequence length 1309
Comment PKD domain-containing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKHLTNIRRSLTAGIILVALLLFNNLSVGLDVVHAQEELVVPTPGMVITQDVTFRPGEYY
FPNGEGIVIAADNITVDGNGAVLVGPGRAGDPESFLGTAVTSTGHSNVVLKNLTAKGFQL
GLKVTNGQNWTITGNNFSDNYTDPDFGWGDGPNFGAVMLVSVHRSAITNNRGERVWNGLH
LRYSNENTIRDNYFSHCSNVCLKMWASSRNLIENNVMNYGIRVAPGEVHARDSTSVLIET
GSNDNRFLYNDFTHGGDGVFIRPLNGYLSTGNYFEGNDASYAHNNAWECWSPGNIFIRNK
GNYSSYGFWLGGSDHTVLIGNEAAYNGTIKANAPEPFGNAGIAVVHGSSSHFIMSGNYVH
DNKNVGVAIGYKPGYEAYHWIIQQNRIENNATYGIYMYDTRWVDLAGNVLTGNGQGAIYR
GSNVSDIFEREATMDDKAPEAHATISARTVYVGEPVTFDASASSDPQGRELMFRWDLGDG
DISESPLVTHTYVDPGFYRVGLTVNNGHLADLTWFDVYVTLKGTEVGTEGVDPSSWQAKI
PARTVEWVVDPSPPDRIGNPALRSGAAPNLDRGIAREVVVPEGSPTLSFDTYYQIEQGYD
FGFVQVSTDGGHTFRSLANEHTTTQTANDAIQLVKDNVPGFTGESGGWRIETFDLSQYAG
QTLLLAFRYVTDPGVDEPGWWVDNIRVGTQLISDGSTLDGWSPLVIEEEAPYAYIKIDSD
HRVVGDDSVRIESNAATGIWSYFAPDGTWDLSDKDYVALWISFAHEVVGGFNDPQPVIRL
MTDDSNYLEYTPRINYLNPSTVPYSEARDGWQWLQIPLSGNADWVRTSYGQPDISHVRSI
EIATHGSSGRYKLWLDGLIFGANPPEPQITPNIALNSEAQGYPSPEASYTFNGDWNLPEY
DNLWAPLDGYTNNGKIWSNWNSGHRYDWYEVRFEYTREINKLVLDFVSFGSRLQPPRSFQ
VFYWQHGAWYEVENQDRSSSAPVEGTNTVTFDPVFTDKVRVRVENVSSRKGRGTYVGISE
LELFNTRNIAGNSKGSSAGLGTPEPVVSSNLDLSWLPLDGSIKPSSMWKPDVGDNNPSYG
VDFHRLKLFNRVTFYLSERGLPSEVRVQYWTGSSWADVAHPWWMSNRIVAGRNIVSFDTV
RSRKIRIIFPSNSRSQLLELEVVNANLLSGHEITPSASYTSPYDTLWGPLDGSYASSPRW
TSWNSHNAQDWYAVDLGVEMVFSRVNLFFYNDNGGVQPPSGYRVQYWDGNSWVDVQEILR
YPAQPSEGFNTVIFEPVRSRKVRVLGTNQNPVNFGVYIGLTEIELFRWE
Download sequence
Identical sequences D1CB92
525904.Tter_1143 gi|269926256|ref|YP_003322879.1| WP_012875092.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]