SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926314|ref|YP_003322937.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926314|ref|YP_003322937.1|
Domain Number 1 Region: 30-174
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0000000000000562
Family L,D-transpeptidase catalytic domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 318-503
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000196
Family SGL-like 0.084
Further Details:      
 
Domain Number 3 Region: 196-362
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000785
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926314|ref|YP_003322937.1|
Sequence length 616
Comment ErfK/YbiS/YcfS/YnhG family protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MFIRTIRVILAFLISAGLILSYINTSQASGDEYYLVIVKNRQRLYLARGNPESPLWSDVI
KEIPVATGALWTQKGLETPSGYFKVIEKSNRPNQGGYDFSDTGDVVLTPYFMRLAIPNRG
GIGIHTYKGYTLKIWRFGVPGGESTHGCIAGPPNDIQDLYKNYVIPGKTRVWIVDDASEA
FKDVKPPEPAKVTVVNGKTWETVESPTNEQFYAIDMLSDDLGWAVSGDAYYNPRTNKYGW
RSHIWKWDGSKWTLEQTIPYWIHSIYMYNPNEGWAVGQNYMGGFHYDGTKWTKVDRPIPR
VPYMSDVDIISPDNAWMVGGGGEIFHWNGRGWKVDVEPDVMKTLRAVSILPNGNGWAVGG
GWDTVTKETIPMVARVVNGDWKAVDVPVKELFYGVDTLSDDDAWAVGSGGTIIHWNGLQW
KQVSSPTKDRLSDVVMLSSNNGWAVGDEKGVALHWDGKSWYKVKLPLNEKFYELDALPSG
TVWAVGSHGSIIRLTNVSESSSSKNIAGNPSSSNKGPSKDNNVADNNSAESPKPSPEPTQ
IIPDDGKSSGNSSAAGTEAQDGNSSKVIPTPQSSDSGSDPASSTVSSGSGLPVMPAVATG
GLLIALVVGLILRRLL
Download sequence
Identical sequences D1CBF0
gi|269926314|ref|YP_003322937.1| 525904.Tter_1207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]