SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926340|ref|YP_003322963.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926340|ref|YP_003322963.1|
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.72e-36
Family Pyruvate oxidase and decarboxylase Pyr module 0.0053
Further Details:      
 
Domain Number 2 Region: 391-570
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.77e-29
Family Pyruvate oxidase and decarboxylase PP module 0.0069
Further Details:      
 
Domain Number 3 Region: 169-177,205-368
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000000114
Family Pyruvate oxidase and decarboxylase, middle domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926340|ref|YP_003322963.1|
Sequence length 587
Comment 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase/2-oxoglutarate decarboxylase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSEIGKINLLAARALADELIRCGVEHVCLSPGSRSAPMAIAFAETGRRLWVHFDERSTAF
FALGLAKHSRKPVVALCTSGTASSNFYPAVIEASYSATPLIVITCDRPPELVDFGSPQTI
DQSKLYGIYPKWHINLPVPSDDFQVDRYLKAVARRAYQTALSFPAGVVHLNFPFREPLIP
EEIENRKDDSCEDMHSILTPDLEGTSPLSKASASKISDLLQQSRRGWIVCGYSGGSDHLD
SILELSARLGYLLVADRVSNLGIHNVDRSLLISSYDLLLGGDPRYLPEPPEVVLRIGASP
TSKNLNRYLRQLDLKFSILLDNFGRWHDPDWAADIVIQSSAKEFVDSVLQFLPDRLNRDV
GWLSKWAELDSLVSCKLAETVLGINNALFEGRIFFELSDALPAGSQIFVGNSMPVRDLET
YFPFTDKAFHIFANRGANGIDGVLSTATGVAASSGKPVFLVIGDLSFAHDAIALSISVKH
SIPIKVILVNNNGGGIFSLLPYRNHEEFFELLFGTPHNLELGRVAGALGVRYHPCSSWQE
FRDAVLECQNLEGPDLIEIRTDRDINRKIRADIRQEIQKYIASMNPI
Download sequence
Identical sequences D1CBH6
gi|269926340|ref|YP_003322963.1| WP_012875176.1.85100 525904.Tter_1233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]