SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926353|ref|YP_003322976.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926353|ref|YP_003322976.1|
Domain Number 1 Region: 337-530
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-21
Family ABC transporter ATPase domain-like 0.00065
Further Details:      
 
Weak hits

Sequence:  gi|269926353|ref|YP_003322976.1|
Domain Number - Region: 48-169
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000641
Family DNA repair protein MutS, domain III 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926353|ref|YP_003322976.1|
Sequence length 551
Comment DNA mismatch repair protein MutS domain-containing protein, partial [Thermobaculum terrenum ATCC BAA-798]
Sequence
MTDIKRFTSLLWPKEKSSVHISDRVYEDLNLSPIVQKLDIDARHRDAIRQIIQNLPTDLE
TIAYRQEILEDILNDEQLFKELLELLPKIIELRSPSGYHWPGDSPLISVINRISELDRYI
ECLDQLYNALAHAPYVKSKGLTSLREDVARAHDDPTIEHLRKELPSLHEALSETNSVTIG
INLGPDLQPESAAIISFNNYVFKGKKTLLDKLLTTSSEDQRFGIGQLHRSTSGGLPRDGK
LYQELQTLLENAVKPLSKVLDTFKRVSSAPIVALENDIAFYLGAVRLVKHLEKRGLNFCR
PRILPMGQKCFYAESLVNLSLAIQMEARDKIDGSDFSRSVVANDVLVDAEYPLLIVTGPN
RGGKTTFCRAIGQAQVLFQSGLFVPAKEAKISPVDNILTHFPGAETSTIGEGRLDDEIRR
LRELFEESTENSLVLLNEPLTSTSEREALVIAKDFVKGLQLMRARGVLITHLHDLALSVN
ELNMQSESKIRNLVAETSHKNGRVESTFKIKPGEPTSTSFASEIAIKHGLTYEGLQRILK
EKNHRSYIEKN
Download sequence
Identical sequences D1CBI9
gi|269926353|ref|YP_003322976.1| WP_012875189.1.85100 525904.Tter_1246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]