SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926438|ref|YP_003323061.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926438|ref|YP_003323061.1|
Domain Number 1 Region: 282-576
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-70
Family DNA repair protein MutS, domain III 0.00000582
Further Details:      
 
Domain Number 2 Region: 579-809
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.37e-63
Family ABC transporter ATPase domain-like 0.000000619
Further Details:      
 
Domain Number 3 Region: 130-294
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.06e-36
Family DNA repair protein MutS, domain II 0.00035
Further Details:      
 
Domain Number 4 Region: 20-128
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.97e-34
Family DNA repair protein MutS, domain I 0.0000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926438|ref|YP_003323061.1|
Sequence length 930
Comment DNA mismatch repair protein MutS [Thermobaculum terrenum ATCC BAA-798]
Sequence
MPEDPVESLIRNIDNKLAARDLVPSRRQYLELKRKYPHAILLYRMGDFYEAFDDDARVVA
RDARVTLTSRTFGRSGRVPMAGVPHHALNYYLSRLLNAGHTVAIAEQMSEPGKGLVEREV
TRVLTPGTVVESALLPAGENRYLAAVYDVGARIGIAWVDVSTGEFRLMELRGEDASERLQ
EELARISPAECLIPEGFPYELVLSQSHATTVRRQNCDPQVAYQLLCKHFGVRSLDAFGCH
DAKASLGAAGAIYTYIEQTNPSLLCMLTSIRMECAEDMVGMDPATRRNLELTRSFGTGGS
RGSLLGVVDQTSTPMGSRAMRRLINTPLRDLQEIRRRQDIIEPLVQMPQVRARIANQLVQ
IGDLERAVSRCTQSGSTLRDFLSLSSALGHVDSLVRILSGTHQQALANLASSIDTCEDIL
SRLQMAVAEADDGSPVILPGFMPELGDALEELRSAREWLARLEQKERERTGIRSLKVGYN
KVFGYYIEVTRPNLHLVPREYVRKQTISTGERFVTEALKEVESRITRAEDAIERLQNEAI
ALLRSLVSANTRRLLATAQLLAEMDALVALAEVASRCGWVRPLVDDSDVIEIRNGRHPVV
ESSLEGERFVPNDCYIGGNWPRVLLITGPNMGGKSTYLRQVALIVLLAQIGSFVPAESAR
IGLVDRIFTRVGAHDDLARGASTFMVEMVETATILNGATERSLVVLDEIGRGTSTYDGMA
IAQAVLEDIHDRVRARTLFATHYLELTTVAKKLPSAQNVHVSVAEERDHIVFLYSVRPGA
ADRAYGIHVARLAGLPPWVAGRAENILHALSAGTEGESTRDKEDEGANSLVSKVDINNAS
CHLAKHLFEPGERYTCSENPLPVKISAVKTLEGSMLAYQGVLEGFEPSRSELEGVAEDIL
DTDLACLSPVEALQKIEEWQQRLRGMRSDL
Download sequence
Identical sequences D1CBS4
525904.Tter_1332 gi|269926438|ref|YP_003323061.1| WP_012875274.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]