SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926476|ref|YP_003323099.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926476|ref|YP_003323099.1|
Domain Number 1 Region: 128-399
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.04e-106
Family BC ATP-binding domain-like 0.000000169
Further Details:      
 
Domain Number 2 Region: 688-949
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-96
Family BC ATP-binding domain-like 0.00000174
Further Details:      
 
Domain Number 3 Region: 394-547
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 4.58e-52
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.000054
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.08e-47
Family BC N-terminal domain-like 0.00000608
Further Details:      
 
Domain Number 5 Region: 552-690
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.87e-37
Family BC N-terminal domain-like 0.0000202
Further Details:      
 
Domain Number 6 Region: 951-1086
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.22e-28
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926476|ref|YP_003323099.1|
Sequence length 1095
Comment carbamoyl-phosphate synthase large subunit [Thermobaculum terrenum ATCC BAA-798]
Sequence
MPIRSDVKKVMVIGSGPIIISQAAEFDYSGSQACKALREEGIFVVLVNSNPATIMTDEAT
ADRVYIEPLNVDVLEKIISRERPDGILPTLGGQTGLNLAVELASAGIVDKYGVKLLGTSL
ESIKQAEDRLLFKQLLQEIGEPVIESMTVHSVQEAIAFANQIGYPLISRPAYTLGGTGGG
IAHNQGELTKLIEHSLRASPIGQTLLERSIEGWKEIEYEVIRDSADNAIIVCNMENIDPV
GVHTGDSIVVAPSQTLTDRQYQILRDSALRIVRALKIEGGCNVQFALDPKSDDYYVIEVN
PRVSRSSALASKATGYPIARVAAKIALGLTLDEIPNAVTSSATAALEPSLDYCVVKIPRW
PFDKFTEGDRRIGTQMKATGEVMAIDRCFEAALQKAVRSLEISGRNLLWESPKWNDPEEL
DRALRVPTDERLWAITTALRRGYTVEDVSKKTKIDPWFIKCIENIVSLEGAIRNSKLDKA
LLWRAKRLGFSDAYIAQIKGVSSEDIRKLRKQWGITPVWKMVDTCAAEFEATTPYFYSTY
EEENEALPQEGRSSVVIGSGPIRIGQGIEFDYCSVHSARSLREAGVKSIMINSNPETVST
DFDTSDRLYFDPLDDESIRDIVENERLETLAEGYPTQSTLEGDELPVAGPPVIVQFGGQT
AINLASKLHRAGFKVLGSSLESIDLAEDRERFDGLLNSLGLLRPPGGTARDLDSALETAT
RIGYPLLVRPSYVLGGQAMRIVYNEVELLDYIDAATEVSGDHPVLLDRYIEGTEVEVDAV
SDGETVVIPGIVEHIERAGVHSGDSFGVYPQITLDDRDVSQIEEITVKLARAMNVKGLMN
VQFVVQDHQVYILEVNPRASRTVPFISKVTGVPLVTLATHVMLGSKLANMGYATGLVPRV
PLYAVKAPVFSMSKLAGVDTVLGPDMKSTGEVMGVDVEYEPALMKAMIAAGINPPPGGSV
LMSIADHEKPEALPLAAALVDMGYALVCTEGTSTFFEDNGIRVNQVVHKIGSVRPDITDI
IRRRQVSLVINTPSRSGRTIRDGFEIRRAAAESGIPCLTSLDTAKSLVKALQRRGDYNIA
TVVEYRQGAVDLLAV
Download sequence
Identical sequences D1CBW2
525904.Tter_1370 gi|269926476|ref|YP_003323099.1| WP_012875312.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]