SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926491|ref|YP_003323114.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926491|ref|YP_003323114.1|
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-45
Family G proteins 0.0000465
Further Details:      
 
Domain Number 2 Region: 171-264
Classification Level Classification E-value
Superfamily Translation proteins 4.71e-24
Family Elongation factors 0.00041
Further Details:      
 
Domain Number 3 Region: 263-360
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.35e-17
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0041
Further Details:      
 
Domain Number 4 Region: 569-617
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000653
Family C-terminal fragment of elongation factor SelB 0.0022
Further Details:      
 
Domain Number 5 Region: 434-502
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000916
Family C-terminal fragment of elongation factor SelB 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|269926491|ref|YP_003323114.1|
Domain Number - Region: 513-559
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00163
Family C-terminal fragment of elongation factor SelB 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926491|ref|YP_003323114.1|
Sequence length 619
Comment selenocysteine-specific translation elongation factor [Thermobaculum terrenum ATCC BAA-798]
Sequence
MFVIGTAGHVDHGKSTLVKALTGIDPDRLQEEKAREMTIDLGFAWLKLPSGREVSIVDVP
GHERFIKNMLAGVGGIDAAILVIAADEGVMPQTKEHLAILDLLEISKAVVALTKVDLVDE
EWLSLVYEDVFQLLKGTVLEGSPIVCVSSRTGKGLGDLVKILDSILVDSPRSVKGVPRLP
IDRVFTIKGFGTVVTGTLIEGSLILGQEVEILPTGKRARIRGLQSHKNQISSVGPGRRVA
VNLSGVDVSDIQRGDVLVTPGKFRPTKRIDVYVRAVSDLDDPITHADKLEFFSGTTQSQA
ILSLLGIDTIDPGSSGYAQLRLSDPVVVSPGDYFILRKASPSVTVGGGIVLSPYPRRHKR
SDSAILQLMNILHRGSINDKVVSILSLYGPMPLNDLLMSLGYAHEDDIRGMIANSQLISI
SSGYNSDSLVMTREFWDSIEQGVTIELHEYHSNFPLRKGMPKEEFRKKLPVPLRFTSAVL
HKLIEDNIIKDLGDSVSATDWRLEVPAYLKYKADRILESIRAGGSSPPSPTEIDADRELL
QALVDMGKLVKVDDDIYFSIDVYEDMVDKILADIDKSGPITVARARDLLGTSRKYVLALL
EYMDEQRITRRSGDYRVRR
Download sequence
Identical sequences D1CBX7
525904.Tter_1385 gi|269926491|ref|YP_003323114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]