SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926501|ref|YP_003323124.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926501|ref|YP_003323124.1|
Domain Number 1 Region: 5-35
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000208
Family B-box zinc-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926501|ref|YP_003323124.1|
Sequence length 164
Comment hypothetical protein Tter_1396 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MIVEQEVRCPRHPDQVTSLTCSRCGKPVCFRCMVYTPVGIRCRECASNPRSGVYAPSMGQ
IAKSFLAVLPLSIVLGALWMMYPRYAFWIALVLGFVGGEIISLVSGRKRGPEMQAVAAIA
VLLAVAIGLVGEVLRGISLGNNMDFLFQIIMAVVALFLAVARQR
Download sequence
Identical sequences D1CBY7
525904.Tter_1396 gi|269926501|ref|YP_003323124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]