SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926505|ref|YP_003323128.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926505|ref|YP_003323128.1|
Domain Number 1 Region: 223-424
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.25e-49
Family ATP-dependent DNA ligase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 5.75e-49
Family ATP-dependent DNA ligase DNA-binding domain 0.00067
Further Details:      
 
Domain Number 3 Region: 433-576
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.48e-37
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926505|ref|YP_003323128.1|
Sequence length 583
Comment ATP-dependent DNA ligase I [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLFSKLAEYFEQLDHTTSRNTLVAILADLYSQCDQSEVRPITYLLQGRLAPFFKPIEIGM
GINYVADAIGKAFGVDRKHVMQVFDRVGDIGTAARQVQQEAGKELSMEETPTVLEIFNQL
MAISQVSGQGSIEKKIGMFADILQKLDPRSVTYICRIPVGTLRLGVGDPTILDALSFAKS
GDKSLRKPLERAYNETSDLGLIAETLWKDGIEGVEKLSIMPGNPVRPALAERLPTPEAII
NRMGQCAVEKKYDGFRCQVHKIGNEVKIFSRNLEDMTGMFPEITSGTLAMVDAETAIFEG
EALAYHPLSGEFLPFQVTTKRRRKHKIEEAAQELPLKLFAFDILYKNGENLMGMKYVDRR
EILANTIKGEDSLIVSDWVIADNVEKLMEVFNEAIESGLEGIVAKRLDSPYQAGARNFNW
VKLKRTHAGQLQDTVDCVIVGYIYGRGKRAQLGAGALLVAVYNPDKDTFQTITKIGTGLT
DEEWKEVVERCKPYVTEEKPARVESIIQPSVWVEPAVVIEVLADEITRSPVHTAGMNGEK
QGYALRFPRLVSFRESDKRPEDATTVQEIIEMYQQQAIKQVAS
Download sequence
Identical sequences D1CBZ1
525904.Tter_1400 WP_012875341.1.85100 gi|269926505|ref|YP_003323128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]