SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926594|ref|YP_003323217.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926594|ref|YP_003323217.1|
Domain Number 1 Region: 5-247
Classification Level Classification E-value
Superfamily PHP domain-like 4.45e-45
Family PHP domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926594|ref|YP_003323217.1|
Sequence length 272
Comment HisJ family histidinol phosphate phosphatase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSKTLFDYHNHTYLCGHATGTAEEYVVAAIRLGLTEIGISDHIPMYWLPVDKRDPTIAMS
EDKLESYVDTVLSLKSVYPEITIRLGIEADYIPGSEEKLERLLEQYPWDYVYGSVHFIDD
WGFDNPEYAHRYEEWDLLELYEKYFEIIASAARSRLFDIIGHIDVIKKWGHEPLESPIEL
YKHVADVIAESGLAVELNTAGYRKPVGKLYPSGDLLRELVSREVDFVLGSDSHQPSEVGY
RLEDALHEAQAYGAIRLVGFSQRRKFSMGQVE
Download sequence
Identical sequences D1CC80
gi|269926594|ref|YP_003323217.1| WP_012875430.1.85100 525904.Tter_1489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]