SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926601|ref|YP_003323224.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926601|ref|YP_003323224.1|
Domain Number 1 Region: 3-284
Classification Level Classification E-value
Superfamily Folate-binding domain 8.79e-109
Family Aminomethyltransferase folate-binding domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 286-366
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.08e-22
Family Aminomethyltransferase beta-barrel domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926601|ref|YP_003323224.1|
Sequence length 371
Comment glycine cleavage system T protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSKNTRQTPLYHEHLKLGAKMTDFAGWEMPLQYEGVITEHQAVRTNAGIFDLSHMGEFEI
TGENAVHFLNYCLTNNAAKLKIGQAQYTLIPYTDGSVADDAILYRLDEDKYLLVVNAANT
QKDLEWLSHQKLGFEKVNLEDISDRTALIAIQGPKSEGILQKLTSVDLRNLKYYHITKGE
VTGIDALIARTGYTGEDGFEIFLPWDKATVVWRSLLDAGKDSGLKPAGLGSRDTLRIEAG
MPLYGHELSEQVNPYEAGLDWAVKLDKGDFVGREALEREKQLGPARKLVGFTLLEMGVPR
AEQPIQKQGRQIGFVTSGTFSPTLKKPIGMGYVPSLFARTGTLIDIVIRNKPVKAEIVQL
PFYSRKRGGES
Download sequence
Identical sequences D1CC87
525904.Tter_1496 WP_012875437.1.85100 gi|269926601|ref|YP_003323224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]