SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926724|ref|YP_003323347.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926724|ref|YP_003323347.1|
Domain Number 1 Region: 83-321
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.89e-62
Family BC ATP-binding domain-like 0.0000282
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.35e-46
Family BC N-terminal domain-like 0.0000368
Further Details:      
 
Domain Number 3 Region: 328-443
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.62e-39
Family BC C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 4 Region: 508-579
Classification Level Classification E-value
Superfamily Single hybrid motif 1.16e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926724|ref|YP_003323347.1|
Sequence length 581
Comment Carbamoyl-phosphate synthase L chain ATP- binding protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MFKKILIANRGEIAIRIARTCRDLGVKTVGIYSDSDREAPFLDWMDESYALRGRSSSETY
TNIQKIIEIAKRSSCDAIHPGYGFLSENADFALACQEAGITFIGPSHEAIFKMGDKLRAR
SLAAEAGVPILPGYGPLEKLSEAESFVTEHGLPVVIKAAGGGGGKGLRTVNALSELATAI
ETAQREGLSYFGSSDVYIEKYLPHPRHVEVQIFGRCDGDVFAIGTRDCSTQRRRQKLIEE
APAPLIDDSTRAAMELAAVNLAKAVGYKSAGTVEMLLSPSGDFYFLEMNTRLQVEHTVTE
VVYGCDLVAMQILTAAGYLVDVPSSPLGHAIQCRINAEDVANDFMPVSGRISRLREPAGP
WVRVDSGIASGCELASDYDSLLAKLIVWGKDRREAIDRLRRALMEYVIEGVPSTLDFHRW
MVNRKEFIEGPVSTHFVQDHMDEIRLVGATLSAPSIGSHSYNEENLIVEVDGRRFEVIVY
NSGENKSQKTNTSSSKVRAATSAGLTRRTGEDTLVSPIQGNLLRVLVSEGEMVSAGQPVC
IIESMKMENEIAAHKNGKVSKLLIEPGNPVVVGQPLMEISS
Download sequence
Identical sequences D1CCL0
WP_012875559.1.85100 gi|269926724|ref|YP_003323347.1| 525904.Tter_1619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]