SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926757|ref|YP_003323380.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926757|ref|YP_003323380.1|
Domain Number 1 Region: 17-212
Classification Level Classification E-value
Superfamily DhaL-like 1.83e-37
Family DhaL-like 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|269926757|ref|YP_003323380.1|
Domain Number - Region: 347-394,421-464
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.00586
Family FMN-linked oxidoreductases 0.019
Further Details:      
 
Domain Number - Region: 224-272
Classification Level Classification E-value
Superfamily MTH889-like 0.0876
Family MTH889-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926757|ref|YP_003323380.1|
Sequence length 545
Comment Dak phosphatase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKPEISLEGKNIQTCGVDVLVESLKYSSKWLEQHRERINRLNVFPVPDGDTGDNMLMTML
GAVRAIEEQAPTTMAALADALEEGALMASRGNSGVILSQMIAGFASVIRGFDSLDVRILA
EAFKVASEYGFRAHSEPVEGTMMTVARDIAKSAHQAARNTNSIIDFLSIIIDDARESVKA
TQYMLPKLQQAGVVDAGGEGLVVILDGALRYFKGELLEINEDSFEGADFASVDLEEEDIY
GYCTNFVLRGHNIDVEEFRSKMQSMGTSVLVVGTPAIVKVHVHTEQPGEVLSYALKFGTL
HQIKLDNMGDQYEQNVLHTRTHPSSQITTGLVIVAAGQGFTRMLQREDGVIVVQGGQTMN
PSTGEIIKAVRECPADAVIILPNNPNIIMSAERAVGSAGKRVEVVPTKSMAEGIVASMAY
NPSLTLEENLENIRSAIRNVRSIEVTRAVRDAQVKDVSVKEGDYIGLLDGQIVASGADLS
DVMRHILETIEDLDEYELITLYRGHDLSQRDVESLAEFLKETFPDIAVEVYDGGQPHYQI
IASLE
Download sequence
Identical sequences D1CCP3
525904.Tter_1652 gi|269926757|ref|YP_003323380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]