SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926758|ref|YP_003323381.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926758|ref|YP_003323381.1|
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily L28p-like 1.77e-16
Family Ribosomal protein L28 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926758|ref|YP_003323381.1|
Sequence length 73
Comment 50S ribosomal protein L28 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MARCEVCGKKTQFGRSIQYHHGGKWARRAQKTNRPFKPNVHRQTVMLNGELVKIHICTRC
LRTLAKKAESTAA
Download sequence
Identical sequences D1CCP4
WP_012875593.1.85100 525904.Tter_1653 gi|269926758|ref|YP_003323381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]