SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926764|ref|YP_003323387.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926764|ref|YP_003323387.1|
Domain Number 1 Region: 98-364
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.01e-77
Family Creatinase/aminopeptidase 0.00000157
Further Details:      
 
Domain Number 2 Region: 8-143
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 1.12e-25
Family Creatinase/prolidase N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926764|ref|YP_003323387.1|
Sequence length 369
Comment peptidase M24 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MNNAFLPDYLRRIDKLRKSLADHELDALLVFSQANRRYLTGFTARDVAIGESSGYVLITQ
EKALLLVNSLYIEHAQKEVTAVEPFLVKDKPNIVISDLLRYLGLHKVGFERDYVTYGFID
DLRSHLEDRVELIPVKGLVEAQRVIKDPYEQNMISEAAKIADAAFSKMLDQISPGMTEKQ
VARLLDNLMIELGAEGPSFETIVAAGPNAARPHHEPTDRPVQEGEPIIVDMGAFYRGYCS
DMTRTFCLGKPDSKFEEVYNIVLEAHNTARSAIRAGLDGGEIDAIARGIIDQAGYGEAFT
HSLGHGVGLEVHEKPSLRKNSEDVLQEGMVVTIEPGIYISGWGGVRIESLVLVDNGPSVL
SQAPIFKNR
Download sequence
Identical sequences D1CCQ0
gi|269926764|ref|YP_003323387.1| WP_012875599.1.85100 525904.Tter_1659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]