SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926769|ref|YP_003323392.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926769|ref|YP_003323392.1|
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.67e-77
Family D-glucarate dehydratase-like 0.0000651
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-28
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926769|ref|YP_003323392.1|
Sequence length 382
Comment mandelate racemase/muconate lactonizing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKIESLTLYKVPPRWLFLKIRTDEGLEGWGEPIVEGKADTVAAAISEMADYIVGQPANHI
EDIWQAVYRGGFYRGGPILTSALSGIEQALWDLKGKSLGVPIYELLGGPVRDRMKVYSWV
HGDTPQQLAESVLSRVNAGYQAIKMGVPGPNTWIDTPQKLDLIIESVALVREAVGNDIAI
GVDFHGRIHKGMARSLVRELEPFKLMFIEEPFPPGHEDSLRDLRAITGIPIALGERLYTR
WGFKEIISKGLADVIQPDLSHAGGILEVKKIAAMAEAYDIALAPHCPLGPIALAASLQVD
FCTPNALIQEQSLEIHYHKESELLSYLANPEVFNFSDGYVLLPLDPGLGITIDEEKVRNA
SQIGHNWRSPIWRNVDGSIAEW
Download sequence
Identical sequences D1CCQ5
525904.Tter_1664 WP_012875604.1.85100 gi|269926769|ref|YP_003323392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]