SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926773|ref|YP_003323396.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926773|ref|YP_003323396.1|
Domain Number 1 Region: 120-204
Classification Level Classification E-value
Superfamily RuvA domain 2-like 9.23e-32
Family ComEA-like 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|269926773|ref|YP_003323396.1|
Domain Number - Region: 56-89
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 0.0248
Family Nqo1 middle domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926773|ref|YP_003323396.1|
Sequence length 206
Comment competence protein ComEA [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSDQSNRFSRITDHISVLIISVSMVLLVMLAKPKPEKVANVITQPTLPPTPSTVTVHILG
AVSKPGVYTLPARSRVVDVVKMAGGFTTRADTMSVNLAQILRDEMQVIVPFKAPGSKLGS
NNGQSALNPTHSSGSAAQEPQVAPININTATKEQLEELPGIGPSKAAAIIEFRQKHGPFN
SLEDLLDVPGIGPSTLENIKSMVVFR
Download sequence
Identical sequences D1CCQ9
WP_012875608.1.85100 gi|269926773|ref|YP_003323396.1| 525904.Tter_1668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]