SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926894|ref|YP_003323517.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926894|ref|YP_003323517.1|
Domain Number 1 Region: 296-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-51
Family Ribonuclease PH domain 1-like 0.00000836
Further Details:      
 
Domain Number 2 Region: 4-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-47
Family Ribonuclease PH domain 1-like 0.0000242
Further Details:      
 
Domain Number 3 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.81e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 142-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.11e-27
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 5 Region: 609-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.94e-24
Family Cold shock DNA-binding domain-like 0.00039
Further Details:      
 
Domain Number 6 Region: 553-630
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.1e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 7 Region: 235-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000175
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926894|ref|YP_003323517.1|
Sequence length 733
Comment Polyribonucleotide nucleotidyltransferase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MISKFETIWAGRKLSIETGRIAGQAHGAVLVQYGDTVVLTTAVRADAPSNMDFFPLTVQY
EERMYAAGKIPGGFIRREGRPSENATLAARLTDRPLRPLFPKGYKYEVQIITTVLSTDQQ
NEPDLLSIIGGSAALSISDIPFLGPVGAARVGYIDGEYILNPTADQREESLLDLTVAGTK
DAVIMVEGSAHELPESVMLGAVEFGHRMLQDTIKLQEQLVAVAGKPKHHFDVPEVDEEFT
ARVREWLGDKLKEAVNNPDKVLREEAIAEVKANLIAAMISDDVADPADLTGAVAREFETL
LKEEVRNRILNEGVRPDGRGPKEIRPVSAEVGLLPRTHGSALFTRGQTQIISVVTLGTRR
EEQILDDLGMEESKRFMHHYNFPPYSTGEIRPLRGPSRRDIGHGALVERSLLPVMPSEEE
FPYTVRVVSEVVSSNGSSSMGSVCGSTLALMDAGVPIKAPVSGVAMGLVTGPDGKYVILT
DIQGIEDALGDMDFKVAGTEKGVTGLQMDIKTTGITFDIMREAFEQAREGRMYILGKMLE
AIPEVRSTLSGYAPRILTMKINPEKIGAVIGPGGKTIRAITDATGSQIDIEDDGTILIYS
TNAEGAEEARRRIEMLTRDIEVGQVYTGKVVGIMPYGAFVELAPGKDGLVHISELSDTRV
NRVEDVVKLGDEITVMVTDIDRNGKISLSRRAVLTGETPSSRQSGKLAVASGSQGSKPSR
GGRPSGKPRSSER
Download sequence
Identical sequences D1CD30
gi|269926894|ref|YP_003323517.1| WP_012875727.1.85100 525904.Tter_1789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]