SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926933|ref|YP_003323556.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926933|ref|YP_003323556.1|
Domain Number 1 Region: 87-259
Classification Level Classification E-value
Superfamily alpha/beta knot 1.77e-42
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0001
Further Details:      
 
Domain Number 2 Region: 18-95
Classification Level Classification E-value
Superfamily L30e-like 2.35e-16
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926933|ref|YP_003323556.1|
Sequence length 264
Comment TrmH family RNA methyltransferase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEAREIRKSHEQESVKPSGRVYIYGRNAVRECLLAGRRKVYRLLVAYSHSASQTLEAIES
LAARSGLQIERVERSILDRLTHGANHQGVVIEASEFSYSSIEDLLASGELRGKDILMLDS
LQDPQNFGTLLRTAEVFGIGAVIIPEHRSVEVTPAVVNASSGATEHLNISKVTNLARTAS
KLKEYGYWVLGLEYDESSSVIWDVDLRIPICLVVGSEGSGIRELVRKRCDLLVKIPQAGR
IGSLNAAVAGSIALYEIYKSKSSK
Download sequence
Identical sequences D1CD69
525904.Tter_1828 WP_012875765.1.85100 gi|269926933|ref|YP_003323556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]