SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926934|ref|YP_003323557.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926934|ref|YP_003323557.1|
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.97e-98
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000247
Further Details:      
 
Domain Number 2 Region: 330-451
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.15e-27
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926934|ref|YP_003323557.1|
Sequence length 453
Comment cysteinyl-tRNA synthetase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLYIHNTLTDRKEEFIPLNPPNVLMYVCGPTVYGPAHIGHAMSYTVFDIVRRYLEYKGYK
VKHVQNFTDVDDKIIARSNEEGISWKDLATRYEREFLRQMDSLNILRAHYYPRASEVIPE
IIEDIQRLIARGYAYVVDGDVYFRVLKDEEYGELSHRRLDEMRAGARIEADPRKEHPMDF
ALWKSAKLGEPYWESPWGPGRPGWHIECTTMNLRMLGEQIDIHGGGADLIFPHHENEIAQ
SEAITGKHPFVRYWIHNGLLQLEEEKMARSVGNVLSIDFIVRQYGADAFRLFVLSSHYRK
PLNFSFEALESAKRGVLRLYQAVGEDAGPAGSEFKDFRQRFESAMDDDFNTPQAIAVLFE
LARDVNALRSEGKDASTAAGLLRELSALLGLRLDSVGGEATEAEPFIDLIVGVRDKLRAS
RIYELSDYIRDKLGELGVSVMDTPEGSKWRLER
Download sequence
Identical sequences D1CD70
gi|269926934|ref|YP_003323557.1| 525904.Tter_1829 WP_012875766.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]