SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926942|ref|YP_003323565.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926942|ref|YP_003323565.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 9.55e-56
Family Obg GTP-binding protein N-terminal domain 0.00000217
Further Details:      
 
Domain Number 2 Region: 148-332
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.03e-52
Family G proteins 0.00000602
Further Details:      
 
Domain Number 3 Region: 357-427
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 3.27e-17
Family Obg GTP-binding protein C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926942|ref|YP_003323565.1|
Sequence length 435
Comment GTP-binding protein Obg/CgtA [Thermobaculum terrenum ATCC BAA-798]
Sequence
MVDQVVIEVKAGDGGNGSASLRREKFVPKGGPDGGDGGRGGSVYLVADPSENTLLPYTFK
KRYVAESGGHGRSQKRHGKAGADLFLPVPVGTVVYDDETGELLADLSTPGQKVLVARGGR
GGLGNTHFATSTYQTPRFAEKGEPGEERRLRLELKLLADVSLVGLPNAGKSTLLSAISSA
RPKIGNYPFTTLEPVLGVVQVPGSEKSFVVADIPGLVEGAHEGTGLGDEFLRHIERTRVL
LFVVDGSSQDGVDPLDAIRILREELRYYDPKLLERPSLVAFNKIDLPEAQQRWESFKKEV
ETLGYEALPVSGASREGLRELIYKLSQMLENAPPIGTFAPQEEQAVIRPRSIDHRWYQIR
RKGKRTWEVHGPTIERIAVMTDITNPEAVNRLEREMDRMGITKDLENAGIEPGHVVRIGG
VEIEWGPSLDKDQNK
Download sequence
Identical sequences D1CD78
525904.Tter_1837 WP_012875774.1.85100 gi|269926942|ref|YP_003323565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]