SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379744428|ref|YP_005335480.1| from Vibrio cholerae IEC224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379744428|ref|YP_005335480.1|
Domain Number 1 Region: 5-170
Classification Level Classification E-value
Superfamily MtlR-like 4.97e-59
Family MtlR-like 0.000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379744428|ref|YP_005335480.1|
Sequence length 176
Comment mannitol repressor protein [Vibrio cholerae IEC224]
Sequence
MAEKINESDILERLNQTHTVRGFFITTVDVLTEAIDALMQRIFRKDNFAVKSVVEPLLHD
TGPLGDLTVRLKLLFGLGVIPDEVFHDIEHLIKLRNQLNHDATEYQFTDPQILAPIKALN
LVKKMGMLHLNVVEPDDDIDLSFYHLQLQRQQQVIKSGLSLAIIQICNALNKDSPF
Download sequence
Identical sequences A0A067B7X8 A0A085Q1W0 A0A0K9UVU6 C2HZ54
WP_000818298.1.15134 WP_000818298.1.17738 WP_000818298.1.2849 WP_000818298.1.34643 WP_000818298.1.36973 WP_000818298.1.42885 WP_000818298.1.53085 WP_000818298.1.65528 WP_000818298.1.70775 WP_000818298.1.89719 gi|379744428|ref|YP_005335480.1| gi|384423300|ref|YP_005632659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]