SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379740557|ref|YP_005332526.1| from Vibrio cholerae IEC224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379740557|ref|YP_005332526.1|
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily TrpR-like 1.73e-30
Family Trp repressor, TrpR 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379740557|ref|YP_005332526.1|
Sequence length 103
Comment Trp operon repressor [Vibrio cholerae IEC224]
Sequence
MVQQPSFSEWQQVLDLVKQAVQQEQHEMLLTMLMTPDEREALVARVNIVHELLQGELSQR
QISQMLGVGIATITRGSNELKSRSEDEKAALAQLLMPPPSSEA
Download sequence
Identical sequences A0A0H3QAK2 A0A0H6A1Q8 A0A0K9UV66 Q9KU28
gi|229608699|ref|YP_002879347.1| gi|379740557|ref|YP_005332526.1| gi|360034611|ref|YP_004936374.1| 593588.VCD_003621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]